Lineage for d3ufxa2 (3ufx A:122-288)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356635Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1356715Family c.23.4.0: automated matches [227303] (1 protein)
    not a true family
  6. 1356716Protein automated matches [227129] (1 species)
    not a true protein
  7. 1356717Species Thermus aquaticus [TaxId:271] [226811] (1 PDB entry)
  8. 1356718Domain d3ufxa2: 3ufx A:122-288 [217353]
    Other proteins in same PDB: d3ufxa1, d3ufxd1, d3ufxf1, d3ufxh1
    automated match to d2scua2
    complexed with gdp, mn

Details for d3ufxa2

PDB Entry: 3ufx (more details), 2.35 Å

PDB Description: thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+
PDB Compounds: (A:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d3ufxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ufxa2 c.23.4.0 (A:122-288) automated matches {Thermus aquaticus [TaxId: 271]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg

SCOPe Domain Coordinates for d3ufxa2:

Click to download the PDB-style file with coordinates for d3ufxa2.
(The format of our PDB-style files is described here.)

Timeline for d3ufxa2: