Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries) |
Domain d3ucga1: 3ucg A:167-253 [217298] Other proteins in same PDB: d3ucga2 automated match to d2cpea1 complexed with edo, peg, pge, so4 |
PDB Entry: 3ucg (more details), 1.95 Å
SCOPe Domain Sequences for d3ucga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucga1 d.58.7.0 (A:167-253) automated matches {Human (Homo sapiens) [TaxId: 9606]} meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv rtslaldeslfrgrqikvipkrtnrpg
Timeline for d3ucga1: