Lineage for d3ucga_ (3ucg A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652682Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1652683Protein automated matches [190896] (7 species)
    not a true protein
  7. 1652701Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)
  8. 1652714Domain d3ucga_: 3ucg A: [217298]
    automated match to d2cpea1
    complexed with edo, peg, pge, so4

Details for d3ucga_

PDB Entry: 3ucg (more details), 1.95 Å

PDB Description: crystal structure of a rna binding domain of polyadenylate-binding protein (pabpn1) from homo sapiens at 1.95 a resolution
PDB Compounds: (A:) Polyadenylate-binding protein 2

SCOPe Domain Sequences for d3ucga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucga_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkes
vrtslaldeslfrgrqikvipkrtnrpg

SCOPe Domain Coordinates for d3ucga_:

Click to download the PDB-style file with coordinates for d3ucga_.
(The format of our PDB-style files is described here.)

Timeline for d3ucga_: