SCOPe 2.08: Domain d3ucga1: 3ucg A:167-253

Lineage for d3ucga1 (3ucg A:167-253)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d3ucga1: 3ucg A:167-253 [217298]
   Other proteins in same PDB: d3ucga2
   automated match to d2cpea1
   complexed with edo, peg, pge, so4

Details for d3ucga1

PDB Entry: 3ucg, 1.95 Å

PDB Description: crystal structure of a rna binding domain of polyadenylate-binding protein (pabpn1) from homo sapiens at 1.95 a resolution

PDB Compounds: (A:) Polyadenylate-binding protein 2

SCOPe Domain Sequences for d3ucga1:

Sequence; same for both SEQRES and ATOM records:

>d3ucga1 d.58.7.0 (A:167-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
rtslaldeslfrgrqikvipkrtnrpg

Timeline for d3ucga1:

• d3ucga1 first appeared in SCOPe 2.03, called d3ucga_
  
• d3ucga1 appears in SCOPe 2.07