SCOPe 2.06: Domain d3uc0m2: 3uc0 M:109-212

Lineage for d3uc0m2 (3uc0 M:109-212)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226268] (1 PDB entry)

8. Domain d3uc0m2: 3uc0 M:109-212 [217276]
   Other proteins in same PDB: d3uc0l1, d3uc0m1
   automated match to d1rhha2
   complexed with gol, so4

Details for d3uc0m2

PDB Entry: 3uc0, 2.71 Å

PDB Description: crystal structure of domain i of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2

PDB Compounds: (M:) Light chain, monoclonal antibody 5H2

SCOPe Domain Sequences for d3uc0m2:

Sequence; same for both SEQRES and ATOM records:

>d3uc0m2 b.1.1.2 (M:109-212) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
rtvaapsvfifppsdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqd
skdntyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3uc0m2:

• d3uc0m2 first appeared in SCOPe 2.03
  
• d3uc0m2 appears in SCOPe 2.05
  
• d3uc0m2 appears in SCOPe 2.07
  
• d3uc0m2 appears in the current release, SCOPe 2.08