Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226267] (1 PDB entry) |
Domain d3uc0m1: 3uc0 M:2-108 [217275] Other proteins in same PDB: d3uc0l2, d3uc0m2 automated match to d1rhha1 complexed with gol, so4 |
PDB Entry: 3uc0 (more details), 2.71 Å
SCOPe Domain Sequences for d3uc0m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uc0m1 b.1.1.0 (M:2-108) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]} elqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvps rfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveik
Timeline for d3uc0m1: