| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226268] (1 PDB entry) |
| Domain d3uc0l2: 3uc0 L:109-210 [217274] Other proteins in same PDB: d3uc0l1, d3uc0m1 automated match to d1rhha2 complexed with gol, so4 |
PDB Entry: 3uc0 (more details), 2.71 Å
SCOPe Domain Sequences for d3uc0l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uc0l2 b.1.1.2 (L:109-210) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
rtvaapsvfifppsdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqd
skdntyslsstltlskadyekhkvyacevthqglsspvtksf
Timeline for d3uc0l2: