SCOPe 2.06: Domain d3u9xa1: 3u9x A:1-231

Lineage for d3u9xa1 (3u9x A:1-231)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries)

8. Domain d3u9xa1: 3u9x A:1-231 [217258]
   Other proteins in same PDB: d3u9xa2
   automated match to d3p1oa_
   complexed with cl, gol, mg

Details for d3u9xa1

PDB Entry: 3u9x, 1.8 Å

PDB Description: Covalent attachment of pyridoxal-phosphate derivatives to 14-3-3 proteins

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3u9xa1:

Sequence, based on SEQRES records:

>d3u9xa1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records):

>d3u9xa1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdy
yrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeiansp
eeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d3u9xa1:

• d3u9xa1 first appeared in SCOPe 2.03, called d3u9xa_
  
• d3u9xa1 was called d3u9xa_ in SCOPe 2.05
  
• d3u9xa1 appears in SCOPe 2.07
  
• d3u9xa1 appears in the current release, SCOPe 2.08