Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Roseiflexus sp. [TaxId:357808] [226247] (1 PDB entry) |
Domain d3u9ib2: 3u9i B:131-371 [217257] Other proteins in same PDB: d3u9ia1, d3u9ib1 automated match to d1jpma1 complexed with so4 |
PDB Entry: 3u9i (more details), 2.9 Å
SCOPe Domain Sequences for d3u9ib2:
Sequence, based on SEQRES records: (download)
>d3u9ib2 c.1.11.0 (B:131-371) automated matches {Roseiflexus sp. [TaxId: 357808]} aatsletdvtittgsvtaaaraaqaivargvttikikigagdpdattirtmehdlariva irdvaptarlildgncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrr vpvaadesvasatdaarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmve sllamtvsacfaagqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtprs p
>d3u9ib2 c.1.11.0 (B:131-371) automated matches {Roseiflexus sp. [TaxId: 357808]} aatsletdvtittgsvtaaaraaqaivargvttikikigagttirtmehdlarivairdv aptarlildgncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrrvpva adesvasatdaarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmveslla mtvsacfaagqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtprsp
Timeline for d3u9ib2: