Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Roseiflexus sp. [TaxId:357808] [226246] (1 PDB entry) |
Domain d3u9ib1: 3u9i B:3-130 [217256] Other proteins in same PDB: d3u9ia2, d3u9ib2 automated match to d1jpma2 complexed with so4 |
PDB Entry: 3u9i (more details), 2.9 Å
SCOPe Domain Sequences for d3u9ib1:
Sequence, based on SEQRES records: (download)
>d3u9ib1 d.54.1.0 (B:3-130) automated matches {Roseiflexus sp. [TaxId: 357808]} mtapttiraltvapldiplhepfgiasgaqevarnllvaveltdgtrgygeaapfpafng etqdmahaailaarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarl plwaffgg
>d3u9ib1 d.54.1.0 (B:3-130) automated matches {Roseiflexus sp. [TaxId: 357808]} mtapttiraltvapldiplhvarnllvaveltdgtrgygeaapfpafngetqdmahaail aarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarlplwaffgg
Timeline for d3u9ib1: