Lineage for d3u9ia2 (3u9i A:131-369)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574145Species Roseiflexus sp. [TaxId:357808] [226247] (1 PDB entry)
  8. 1574146Domain d3u9ia2: 3u9i A:131-369 [217255]
    Other proteins in same PDB: d3u9ia1, d3u9ib1
    automated match to d1jpma1
    complexed with so4

Details for d3u9ia2

PDB Entry: 3u9i (more details), 2.9 Å

PDB Description: The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein

SCOPe Domain Sequences for d3u9ia2:

Sequence, based on SEQRES records: (download)

>d3u9ia2 c.1.11.0 (A:131-369) automated matches {Roseiflexus sp. [TaxId: 357808]}
aatsletdvtittgsvtaaaraaqaivargvttikikigagdpdattirtmehdlariva
irdvaptarlildgncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrr
vpvaadesvasatdaarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmve
sllamtvsacfaagqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtpr

Sequence, based on observed residues (ATOM records): (download)

>d3u9ia2 c.1.11.0 (A:131-369) automated matches {Roseiflexus sp. [TaxId: 357808]}
aatsletdvtitvtaaaraaqaivargvttikikigtirtmehdlarivairdvaptarl
ildgncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrrvpvaadesva
satdaarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmvesllamtvsac
faagqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtpr

SCOPe Domain Coordinates for d3u9ia2:

Click to download the PDB-style file with coordinates for d3u9ia2.
(The format of our PDB-style files is described here.)

Timeline for d3u9ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u9ia1