Lineage for d3u9ia1 (3u9i A:4-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192101Species Roseiflexus sp. [TaxId:357808] [226246] (1 PDB entry)
  8. 2192102Domain d3u9ia1: 3u9i A:4-130 [217254]
    Other proteins in same PDB: d3u9ia2, d3u9ib2
    automated match to d1jpma2
    complexed with so4

Details for d3u9ia1

PDB Entry: 3u9i (more details), 2.9 Å

PDB Description: The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein

SCOPe Domain Sequences for d3u9ia1:

Sequence, based on SEQRES records: (download)

>d3u9ia1 d.54.1.0 (A:4-130) automated matches {Roseiflexus sp. [TaxId: 357808]}
tapttiraltvapldiplhepfgiasgaqevarnllvaveltdgtrgygeaapfpafnge
tqdmahaailaarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarlp
lwaffgg

Sequence, based on observed residues (ATOM records): (download)

>d3u9ia1 d.54.1.0 (A:4-130) automated matches {Roseiflexus sp. [TaxId: 357808]}
tapttiraltvapldiplhevarnllvaveltdgtrgygeaapfpafngetqdmahaail
aarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarlplwaffgg

SCOPe Domain Coordinates for d3u9ia1:

Click to download the PDB-style file with coordinates for d3u9ia1.
(The format of our PDB-style files is described here.)

Timeline for d3u9ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u9ia2