Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Type-1 interleukin-1 receptor [49177] (1 species) duplication: tandem repeat of 3 domains |
Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries) |
Domain d1g0yr3: 1g0y R:205-315 [21725] Other proteins in same PDB: d1g0yi_ |
PDB Entry: 1g0y (more details), 3 Å
SCOPe Domain Sequences for d1g0yr3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0yr3 b.1.1.4 (R:205-315) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} kptrpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysv enpankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypvt
Timeline for d1g0yr3: