Lineage for d1g0yr3 (1g0y R:205-315)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753943Protein Type-1 interleukin-1 receptor [49177] (1 species)
    duplication: tandem repeat of 3 domains
  7. 2753944Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)
  8. 2753956Domain d1g0yr3: 1g0y R:205-315 [21725]
    Other proteins in same PDB: d1g0yi_

Details for d1g0yr3

PDB Entry: 1g0y (more details), 3 Å

PDB Description: il-1 receptor type 1 complexed with antagonist peptide af10847
PDB Compounds: (R:) interleukin-1 receptor, type I

SCOPe Domain Sequences for d1g0yr3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0yr3 b.1.1.4 (R:205-315) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
kptrpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysv
enpankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypvt

SCOPe Domain Coordinates for d1g0yr3:

Click to download the PDB-style file with coordinates for d1g0yr3.
(The format of our PDB-style files is described here.)

Timeline for d1g0yr3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g0yi_