SCOP 1.55: Domain d1g0yr2: 1g0y R:102-204

Lineage for d1g0yr2 (1g0y R:102-204)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)

8. Domain d1g0yr2: 1g0y R:102-204 [21724]
   Other proteins in same PDB: d1g0yi_

Details for d1g0yr2

PDB Entry: 1g0y, 3 Å

PDB Description: il-1 receptor type 1 complexed with antagonist peptide af10847

SCOP Domain Sequences for d1g0yr2:

Sequence; same for both SEQRES and ATOM records:

>d1g0yr2 b.1.1.4 (R:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
nlcynaqaifkqklpvagdgglvcpymeffknennelpklqwykdckpllldnihfsgvk
drlivmnvaekhrgnytchasytylgkqypitrviefitleen

Timeline for d1g0yr2:

• d1g0yr2 appears in SCOP 1.57
  
• d1g0yr2 appears in the current release, SCOPe 2.08