Lineage for d1g0yr1 (1g0y R:6-101)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104958Protein Type-1 interleukin-1 receptor [49177] (1 species)
  7. 104959Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)
  8. 104966Domain d1g0yr1: 1g0y R:6-101 [21723]
    Other proteins in same PDB: d1g0yi_

Details for d1g0yr1

PDB Entry: 1g0y (more details), 3 Å

PDB Description: il-1 receptor type 1 complexed with antagonist peptide af10847

SCOP Domain Sequences for d1g0yr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0yr1 b.1.1.4 (R:6-101) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
ckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkeklw
fvpakvedsghyycvvrnssyclrikisakfvenep

SCOP Domain Coordinates for d1g0yr1:

Click to download the PDB-style file with coordinates for d1g0yr1.
(The format of our PDB-style files is described here.)

Timeline for d1g0yr1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g0yi_