SCOPe 2.08: Domain d1g0yr1: 1g0y R:6-101

Lineage for d1g0yr1 (1g0y R:6-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)
   duplication: tandem repeat of 3 domains

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)

8. Domain d1g0yr1: 1g0y R:6-101 [21723]
   Other proteins in same PDB: d1g0yi_

Details for d1g0yr1

PDB Entry: 1g0y, 3 Å

PDB Description: il-1 receptor type 1 complexed with antagonist peptide af10847

PDB Compounds: (R:) interleukin-1 receptor, type I

SCOPe Domain Sequences for d1g0yr1:

Sequence; same for both SEQRES and ATOM records:

>d1g0yr1 b.1.1.4 (R:6-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
ckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkeklw
fvpakvedsghyycvvrnssyclrikisakfvenep

Timeline for d1g0yr1:

• d1g0yr1 first appeared (with stable ids) in SCOP 1.55
  
• d1g0yr1 appears in SCOPe 2.07