Lineage for d1itbb3 (1itb B:205-315)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365264Protein Type-1 interleukin-1 receptor [49177] (1 species)
    duplication: tandem repeat of 3 domains
  7. 2365265Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)
  8. 2365271Domain d1itbb3: 1itb B:205-315 [21722]
    Other proteins in same PDB: d1itba_

Details for d1itbb3

PDB Entry: 1itb (more details), 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta
PDB Compounds: (B:) type 1 interleukin-1 receptor

SCOPe Domain Sequences for d1itbb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itbb3 b.1.1.4 (B:205-315) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
kptrpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysv
enpankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypvt

SCOPe Domain Coordinates for d1itbb3:

Click to download the PDB-style file with coordinates for d1itbb3.
(The format of our PDB-style files is described here.)

Timeline for d1itbb3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1itba_