SCOP 1.57: Domain d1itbb2: 1itb B:102-204

Lineage for d1itbb2 (1itb B:102-204)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)

8. Domain d1itbb2: 1itb B:102-204 [21721]
   Other proteins in same PDB: d1itba_

Details for d1itbb2

PDB Entry: 1itb, 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta

SCOP Domain Sequences for d1itbb2:

Sequence; same for both SEQRES and ATOM records:

>d1itbb2 b.1.1.4 (B:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
nlcynaqaifkqklpvagdgglvcpymeffknennelpklqwykdckpllldnihfsgvk
drlivmnvaekhrgnytchasytylgkqypitrviefitleen

Timeline for d1itbb2:

• d1itbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1itbb2 appears in SCOP 1.59
  
• d1itbb2 appears in the current release, SCOPe 2.08