Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d3u6rh_: 3u6r H: [217208] automated match to d1ap2b_ complexed with so4 |
PDB Entry: 3u6r (more details), 2.67 Å
SCOPe Domain Sequences for d3u6rh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6rh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlleqsgaevkkpgssvkvscqvfgdtfsrytiqwlrqapgqgpewmgniipvyntpn yaqkfqgrlsitaddststaymelsslrsedtavyfcarvvipnairhtmgyyfdywgqg tlvtvs
Timeline for d3u6rh_: