Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
Domain d3u49b1: 3u49 B:3-259 [217180] Other proteins in same PDB: d3u49a2, d3u49b2 automated match to d1g0na_ |
PDB Entry: 3u49 (more details), 1.75 Å
SCOPe Domain Sequences for d3u49b1:
Sequence, based on SEQRES records: (download)
>d3u49b1 c.2.1.0 (B:3-259) automated matches {Bacillus subtilis [TaxId: 1423]} krtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlagd msdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidaik rasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvncl npgfiatdryhqfvenvmkknsiskqkaeeqiasgipmkrvgsaeetaalaaflaseeas yitgqqisadggsmksi
>d3u49b1 c.2.1.0 (B:3-259) automated matches {Bacillus subtilis [TaxId: 1423]} krtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlagd msdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidaik rasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvncl npgfiatdryhqfvenvmkknsiskqkipmkrvgsaeetaalaaflaseeasyitgqqis adggsmksi
Timeline for d3u49b1:
View in 3D Domains from other chains: (mouse over for more information) d3u49a1, d3u49a2, d3u49c_, d3u49d_ |