Lineage for d3u3ra_ (3u3r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872152Domain d3u3ra_: 3u3r A: [217174]
    automated match to d2z5fa_
    complexed with a3p, npo

Details for d3u3ra_

PDB Entry: 3u3r (more details), 2.36 Å

PDB Description: crystal structure of d249g mutated human sult1a1 bound to pap and p-nitrophenol
PDB Compounds: (A:) Sulfotransferase 1A1

SCOPe Domain Sequences for d3u3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u3ra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
mghsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOPe Domain Coordinates for d3u3ra_:

Click to download the PDB-style file with coordinates for d3u3ra_.
(The format of our PDB-style files is described here.)

Timeline for d3u3ra_: