Lineage for d3u2sb2 (3u2s B:108-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750012Domain d3u2sb2: 3u2s B:108-208 [217159]
    Other proteins in same PDB: d3u2sa_, d3u2sb1, d3u2sh_, d3u2sl1
    automated match to d1aqkl2
    complexed with bu3, nag, so4

Details for d3u2sb2

PDB Entry: 3u2s (more details), 1.8 Å

PDB Description: crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
PDB Compounds: (B:) PG9 light chain

SCOPe Domain Sequences for d3u2sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2sb2 b.1.1.2 (B:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

SCOPe Domain Coordinates for d3u2sb2:

Click to download the PDB-style file with coordinates for d3u2sb2.
(The format of our PDB-style files is described here.)

Timeline for d3u2sb2: