Lineage for d1tiu__ (1tiu -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.4: I set domains [49159] (25 proteins) 
Protein Twitchin [49174] (2 species) 
Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries) 
Domain d1tiu__: 1tiu - [21715]
Details for d1tiu__
PDB Entry: 1tiu (more details)
PDB Description: titin, ig repeat 27, nmr, 24 structures
SCOP Domain Sequences for d1tiu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiu__ b.1.1.4 (-) Twitchin {Human (Homo sapiens), Ig repeat 27}
lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
hncqlgmtgevsfqaanaksaanlkvkel
SCOP Domain Coordinates for d1tiu__:
Click to download the PDB-style file with coordinates for d1tiu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tiu__:
- d1tiu__ first appeared (with stable ids) in SCOP 1.55
- d1tiu__ appears in SCOP 1.57
- d1tiu__ appears in SCOP 1.61
- d1tiu__ appears in the current release, SCOPe 2.08, called d1tiua_
View in 3D