Lineage for d3u0gd_ (3u0g D:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453426Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1453427Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1453510Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1453511Protein automated matches [190815] (7 species)
    not a true protein
  7. 1453512Species Burkholderia pseudomallei [TaxId:28450] [226245] (1 PDB entry)
  8. 1453516Domain d3u0gd_: 3u0g D: [217132]
    automated match to d2eiyb_
    complexed with cl, gol, po4

Details for d3u0gd_

PDB Entry: 3u0g (more details), 1.9 Å

PDB Description: Crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei
PDB Compounds: (D:) Putative branched-chain amino acid aminotransferase IlvE

SCOPe Domain Sequences for d3u0gd_:

Sequence, based on SEQRES records: (download)

>d3u0gd_ e.17.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
dwltki

Sequence, based on observed residues (ATOM records): (download)

>d3u0gd_ e.17.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallld
vdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevy
tadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltki

SCOPe Domain Coordinates for d3u0gd_:

Click to download the PDB-style file with coordinates for d3u0gd_.
(The format of our PDB-style files is described here.)

Timeline for d3u0gd_: