Lineage for d3u0gc_ (3u0g C:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953348Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1953349Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1953446Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1953447Protein automated matches [190815] (10 species)
    not a true protein
  7. 1953448Species Burkholderia pseudomallei [TaxId:28450] [226245] (1 PDB entry)
  8. 1953451Domain d3u0gc_: 3u0g C: [217131]
    automated match to d2eiyb_
    complexed with cl, gol, po4

Details for d3u0gc_

PDB Entry: 3u0g (more details), 1.9 Å

PDB Description: Crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei
PDB Compounds: (C:) Putative branched-chain amino acid aminotransferase IlvE

SCOPe Domain Sequences for d3u0gc_:

Sequence, based on SEQRES records: (download)

>d3u0gc_ e.17.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
dwltki

Sequence, based on observed residues (ATOM records): (download)

>d3u0gc_ e.17.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallld
vdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevy
tadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltki

SCOPe Domain Coordinates for d3u0gc_:

Click to download the PDB-style file with coordinates for d3u0gc_.
(The format of our PDB-style files is described here.)

Timeline for d3u0gc_: