Lineage for d1wiu__ (1wiu -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.4: I set domains [49159] (25 proteins) 
Protein Twitchin [49174] (2 species) Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries) 
Domain d1wiu__: 1wiu - [21713]
Details for d1wiu__
PDB Entry: 1wiu (more details)
PDB Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, 30 structures
SCOP Domain Sequences for d1wiu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiu__ b.1.1.4 (-) Twitchin {Nematode (Caenorhabditis elegans)}
lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
ffpsakradsgnyklkvknelgedeaifevivq
SCOP Domain Coordinates for d1wiu__:
Click to download the PDB-style file with coordinates for d1wiu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wiu__:
- d1wiu__ first appeared (with stable ids) in SCOP 1.55
- d1wiu__ appears in SCOP 1.57
- d1wiu__ appears in SCOP 1.61
- d1wiu__ appears in the current release, SCOPe 2.08, called d1wiua_
View in 3D