Lineage for d1wiu__ (1wiu -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54491Protein Twitchin [49174] (2 species)
  7. 54495Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
  8. 54497Domain d1wiu__: 1wiu - [21713]

Details for d1wiu__

PDB Entry: 1wiu (more details)

PDB Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, 30 structures

SCOP Domain Sequences for d1wiu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiu__ b.1.1.4 (-) Twitchin {Nematode (Caenorhabditis elegans)}
lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
ffpsakradsgnyklkvknelgedeaifevivq

SCOP Domain Coordinates for d1wiu__:

Click to download the PDB-style file with coordinates for d1wiu__.
(The format of our PDB-style files is described here.)

Timeline for d1wiu__: