Lineage for d1koaa1 (1koa A:6265-6361)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295729Protein Twitchin [49174] (2 species)
  7. 1295733Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
    different modules
  8. 1295734Domain d1koaa1: 1koa A:6265-6361 [21712]
    Other proteins in same PDB: d1koaa2

Details for d1koaa1

PDB Entry: 1koa (more details), 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains
PDB Compounds: (A:) twitchin

SCOPe Domain Sequences for d1koaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt
inrvkgddkgeytvraknsygtkeeivflnvtrhsep

SCOPe Domain Coordinates for d1koaa1:

Click to download the PDB-style file with coordinates for d1koaa1.
(The format of our PDB-style files is described here.)

Timeline for d1koaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1koaa2