Lineage for d1koa_1 (1koa 6265-6361)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54491Protein Twitchin [49174] (2 species)
  7. 54495Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
  8. 54496Domain d1koa_1: 1koa 6265-6361 [21712]
    Other proteins in same PDB: d1koa_2

Details for d1koa_1

PDB Entry: 1koa (more details), 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains

SCOP Domain Sequences for d1koa_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koa_1 b.1.1.4 (6265-6361) Twitchin {Nematode (Caenorhabditis elegans)}
qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt
inrvkgddkgeytvraknsygtkeeivflnvtrhsep

SCOP Domain Coordinates for d1koa_1:

Click to download the PDB-style file with coordinates for d1koa_1.
(The format of our PDB-style files is described here.)

Timeline for d1koa_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1koa_2