Lineage for d1ncu__ (1ncu -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein Titin [49172] (1 species) Species Human (Homo sapiens), module M5 [TaxId:9606] [49173] (4 PDB entries) 
Domain d1ncu__: 1ncu - [21709]
Details for d1ncu__
PDB Entry: 1ncu (more details)
PDB Description: titin module m5, n-terminally extended, nmr
SCOP Domain Sequences for d1ncu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncu__ b.1.1.4 (-) Titin {Human (Homo sapiens), module M5}
skttlaariltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttky
kstfeissvqasdegnysvvvensegkqeaeftltiqk
SCOP Domain Coordinates for d1ncu__:
Click to download the PDB-style file with coordinates for d1ncu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncu__:
- d1ncu__ appears in SCOP 1.57
- d1ncu__ appears in the current release, SCOPe 2.08, called d1ncua1
View in 3D