SCOPe 2.08: Domain d1ncua1: 1ncu A:-5-91

Lineage for d1ncua1 (1ncu A:-5-91)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Titin [49172] (1 species)

7. Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries)

8. Domain d1ncua1: 1ncu A:-5-91 [21709]
   Other proteins in same PDB: d1ncua2
   module M5

Details for d1ncua1

PDB Entry: 1ncu

PDB Description: titin module m5, n-terminally extended, nmr

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1ncua1:

Sequence; same for both SEQRES and ATOM records:

>d1ncua1 b.1.1.4 (A:-5-91) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
kttlaariltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkyk
stfeissvqasdegnysvvvensegkqeaeftltiqk

Timeline for d1ncua1:

• d1ncua1 first appeared (with stable ids) in SCOP 1.55, called d1ncu__
  
• d1ncua1 appears in SCOPe 2.07