Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Escherichia coli [TaxId:562] [224854] (1 PDB entry) |
Domain d3tyfa2: 3tyf A:115-202 [217087] Other proteins in same PDB: d3tyfa1, d3tyfb1, d3tyfc1, d3tyfd1 automated match to d1qrnd2 complexed with gol |
PDB Entry: 3tyf (more details), 2.81 Å
SCOPe Domain Sequences for d3tyfa2:
Sequence, based on SEQRES records: (download)
>d3tyfa2 b.1.1.2 (A:115-202) automated matches {Escherichia coli [TaxId: 562]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d3tyfa2 b.1.1.2 (A:115-202) automated matches {Escherichia coli [TaxId: 562]} iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav awsnkdfacanafnnsiipedtffp
Timeline for d3tyfa2: