Lineage for d3tvra1 (3tvr A:0-159)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215439Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries)
  8. 2215440Domain d3tvra1: 3tvr A:0-159 [217046]
    Other proteins in same PDB: d3tvra2
    automated match to d3tl1b_
    complexed with gol

Details for d3tvra1

PDB Entry: 3tvr (more details), 1.8 Å

PDB Description: crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi
PDB Compounds: (A:) Polyketide cyclase

SCOPe Domain Sequences for d3tvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvra1 d.129.3.0 (A:0-159) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdad
gkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdap
vddawmtdninrnsrtqmalirdrieqaagerrtasvlad

SCOPe Domain Coordinates for d3tvra1:

Click to download the PDB-style file with coordinates for d3tvra1.
(The format of our PDB-style files is described here.)

Timeline for d3tvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tvra2