SCOPe 2.06: Domain d3trna_: 3trn A:

Lineage for d3trna_ (3trn A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Mason-pfizer monkey virus [TaxId:11855] [225168] (16 PDB entries)

8. Domain d3trna_: 3trn A: [217022]
   automated match to d1q5hc_
   complexed with ump

Details for d3trna_

PDB Entry: 3trn, 1.83 Å

PDB Description: crystal structure of m-pmv dutpase post-inversion product (dump) complex

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotido hydrolase

SCOPe Domain Sequences for d3trna_:

Sequence; same for both SEQRES and ATOM records:

>d3trna_ b.85.4.0 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]}
kqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssitm
kglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq

Timeline for d3trna_:

• d3trna_ first appeared in SCOPe 2.03
  
• d3trna_ appears in SCOPe 2.05
  
• d3trna_ appears in SCOPe 2.07
  
• d3trna_ appears in the current release, SCOPe 2.08