Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Neural cell adhesion molecule (NCAM) [49166] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries) Rat and mouse sequences are identical for the two N-terminal modules |
Domain d1epfd2: 1epf D:98-189 [21701] Other proteins in same PDB: d1epfb3, d1epfc3, d1epfd3 modules 1 and 2 complexed with ca |
PDB Entry: 1epf (more details), 1.85 Å
SCOPe Domain Sequences for d1epfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epfd2 b.1.1.4 (D:98-189) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]} klmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi rgikktdegtyrcegrilargeinfkdiqviv
Timeline for d1epfd2: