Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (28 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [226218] (1 PDB entry) |
Domain d3tqtb1: 3tqt B:4-139 [216992] Other proteins in same PDB: d3tqta2, d3tqtb2 automated match to d1ehib1 |
PDB Entry: 3tqt (more details), 1.88 Å
SCOPe Domain Sequences for d3tqtb1:
Sequence, based on SEQRES records: (download)
>d3tqtb1 c.30.1.0 (B:4-139) automated matches {Coxiella burnetii [TaxId: 227377]} klhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemflahs pdhlvkegsarpitiafgdaakpwqslngdgrrysadcvfpmvhgtqgedgalqgllell nlpyvganvqssavcm
>d3tqtb1 c.30.1.0 (B:4-139) automated matches {Coxiella burnetii [TaxId: 227377]} klhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemflahs pdhlvkegsarpitiafkpwqsldgrrysadcvfpmvhgtqgedgalqgllellnlpyvg anvqssavcm
Timeline for d3tqtb1: