Lineage for d3tqtb1 (3tqt B:4-139)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591668Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1591669Protein automated matches [226903] (25 species)
    not a true protein
  7. 1591693Species Coxiella burnetii [TaxId:227377] [226218] (1 PDB entry)
  8. 1591695Domain d3tqtb1: 3tqt B:4-139 [216992]
    Other proteins in same PDB: d3tqta2, d3tqtb2
    automated match to d1ehib1

Details for d3tqtb1

PDB Entry: 3tqt (more details), 1.88 Å

PDB Description: structure of the d-alanine-d-alanine ligase from coxiella burnetii
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3tqtb1:

Sequence, based on SEQRES records: (download)

>d3tqtb1 c.30.1.0 (B:4-139) automated matches {Coxiella burnetii [TaxId: 227377]}
klhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemflahs
pdhlvkegsarpitiafgdaakpwqslngdgrrysadcvfpmvhgtqgedgalqgllell
nlpyvganvqssavcm

Sequence, based on observed residues (ATOM records): (download)

>d3tqtb1 c.30.1.0 (B:4-139) automated matches {Coxiella burnetii [TaxId: 227377]}
klhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemflahs
pdhlvkegsarpitiafkpwqsldgrrysadcvfpmvhgtqgedgalqgllellnlpyvg
anvqssavcm

SCOPe Domain Coordinates for d3tqtb1:

Click to download the PDB-style file with coordinates for d3tqtb1.
(The format of our PDB-style files is described here.)

Timeline for d3tqtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqtb2