Lineage for d3tqta2 (3tqt A:140-371)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433323Species Coxiella burnetii [TaxId:227377] [226220] (1 PDB entry)
  8. 1433324Domain d3tqta2: 3tqt A:140-371 [216991]
    Other proteins in same PDB: d3tqta1, d3tqtb1
    automated match to d1ehib2

Details for d3tqta2

PDB Entry: 3tqt (more details), 1.88 Å

PDB Description: structure of the d-alanine-d-alanine ligase from coxiella burnetii
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3tqta2:

Sequence, based on SEQRES records: (download)

>d3tqta2 d.142.1.0 (A:140-371) automated matches {Coxiella burnetii [TaxId: 227377]}
ekdltktvlraggipvvdwhtlsprdategvyqrlldrwgtselfvkavslgssvatlpv
kteteftkavkevfryddrlmveprirgreiecavlgngapkaslpgeiiphhdyysyda
kyldpngattttsvdlsesvtkqiqqiaidafkmvhcsgmarvdffvtpnnkvlvneint
ipgftnismypkmweasglpcpnlldqlielaidrhqeqqklircyevkars

Sequence, based on observed residues (ATOM records): (download)

>d3tqta2 d.142.1.0 (A:140-371) automated matches {Coxiella burnetii [TaxId: 227377]}
ekdltktvlraggipvvdwhtlsprdategvyqrlldrwelfvkavslgssvatlpvkte
teftkavkevfryddrlmveprirgreiecavlgngapkaslpgeiiphattttsvdlse
svtkqiqqiaidafkmvhcsgmarvdffvtpnnkvlvneintipgftnismypkmweasg
lpcpnlldqlielaidrhqeqqklircyevkars

SCOPe Domain Coordinates for d3tqta2:

Click to download the PDB-style file with coordinates for d3tqta2.
(The format of our PDB-style files is described here.)

Timeline for d3tqta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqta1