Lineage for d3tqoa2 (3tqo A:317-403)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266734Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1266735Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1266791Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1266792Protein automated matches [226872] (6 species)
    not a true protein
  7. 1266796Species Coxiella burnetii [TaxId:777] [226214] (1 PDB entry)
  8. 1266797Domain d3tqoa2: 3tqo A:317-403 [216983]
    Other proteins in same PDB: d3tqoa1
    automated match to d1li5a1
    complexed with zn

Details for d3tqoa2

PDB Entry: 3tqo (more details), 2.3 Å

PDB Description: structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii.
PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d3tqoa2:

Sequence, based on SEQRES records: (download)

>d3tqoa2 a.27.1.0 (A:317-403) automated matches {Coxiella burnetii [TaxId: 777]}
lerfylalrglpvvnhektssytdrfyeamdddfntpiafallfemvreinrfrdnnqie
kaavlaaelkclgnifgllqyspeqfl

Sequence, based on observed residues (ATOM records): (download)

>d3tqoa2 a.27.1.0 (A:317-403) automated matches {Coxiella burnetii [TaxId: 777]}
lerfylalrglpvssytdrfyeamdddfntpiafallfemvreinrfrdnnqiekaavla
aelkclgnifgllqyspeqfl

SCOPe Domain Coordinates for d3tqoa2:

Click to download the PDB-style file with coordinates for d3tqoa2.
(The format of our PDB-style files is described here.)

Timeline for d3tqoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqoa1