Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (6 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [226214] (1 PDB entry) |
Domain d3tqoa2: 3tqo A:317-403 [216983] Other proteins in same PDB: d3tqoa1 automated match to d1li5a1 complexed with zn |
PDB Entry: 3tqo (more details), 2.3 Å
SCOPe Domain Sequences for d3tqoa2:
Sequence, based on SEQRES records: (download)
>d3tqoa2 a.27.1.0 (A:317-403) automated matches {Coxiella burnetii [TaxId: 777]} lerfylalrglpvvnhektssytdrfyeamdddfntpiafallfemvreinrfrdnnqie kaavlaaelkclgnifgllqyspeqfl
>d3tqoa2 a.27.1.0 (A:317-403) automated matches {Coxiella burnetii [TaxId: 777]} lerfylalrglpvssytdrfyeamdddfntpiafallfemvreinrfrdnnqiekaavla aelkclgnifgllqyspeqfl
Timeline for d3tqoa2: