Lineage for d3tozf2 (3toz F:113-291)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831530Species Listeria monocytogenes [TaxId:169963] [226203] (3 PDB entries)
  8. 1831544Domain d3tozf2: 3toz F:113-291 [216939]
    Other proteins in same PDB: d3toza1, d3tozb1, d3tozc1, d3tozd1, d3toze1, d3tozf1, d3tozg1, d3tozh1
    automated match to d1vi2b1
    complexed with cl, nad, so4

Details for d3tozf2

PDB Entry: 3toz (more details), 2.2 Å

PDB Description: 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with nad.
PDB Compounds: (F:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tozf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tozf2 c.2.1.0 (F:113-291) automated matches {Listeria monocytogenes [TaxId: 169963]}
dgtgymralkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaek
tvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpe
livsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf

SCOPe Domain Coordinates for d3tozf2:

Click to download the PDB-style file with coordinates for d3tozf2.
(The format of our PDB-style files is described here.)

Timeline for d3tozf2: