SCOPe 2.04: Domain d3toia_: 3toi A:

Lineage for d3toia_ (3toi A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)

8. Domain d3toia_: 3toi A: [216914]
   automated match to d1omeb_

Details for d3toia_

PDB Entry: 3toi, 1.9 Å

PDB Description: Tailoring Enzyme Stability and Exploiting Stability-Trait Linkage by Iterative Truncation and Optimization

PDB Compounds: (A:) Ampicillin resistance protein

SCOPe Domain Sequences for d3toia_:

Sequence; same for both SEQRES and ATOM records:

>d3toia_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
ggarvgyieldlnsgkvlesfrpeerfpmmstfkvllcgavlsridagqeqlgrrihysq
ndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggpkeltaflhnmgdhv
trldrwepelneaipnderdtttpvamattlrkllsgelltlasrqqlmdwmeadkvagp
llrsvlpagwfiadksgagehgsrgiiaalgpdgkpsrivviymtgsqatmdernrqiae
igasligg

Timeline for d3toia_:

• d3toia_ first appeared in SCOPe 2.03
  
• d3toia_ appears in SCOPe 2.05
  
• d3toia_ appears in the current release, SCOPe 2.08, called d3toia1