SCOPe 2.05: Domain d3tnwd1: 3tnw D:176-308

Lineage for d3tnwd1 (3tnw D:176-308)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (3 PDB entries)

8. Domain d3tnwd1: 3tnw D:176-308 [216911]
   Other proteins in same PDB: d3tnwa_, d3tnwc_
   automated match to d3ddqb1
   complexed with f18, na

Details for d3tnwd1

PDB Entry: 3tnw, 2 Å

PDB Description: Structure of CDK2/cyclin A in complex with CAN508

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3tnwd1:

Sequence; same for both SEQRES and ATOM records:

>d3tnwd1 a.74.1.1 (D:176-308) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvlafdlaa

Timeline for d3tnwd1:

• d3tnwd1 first appeared in SCOPe 2.03
  
• d3tnwd1 appears in SCOPe 2.04
  
• d3tnwd1 appears in SCOPe 2.06
  
• d3tnwd1 appears in the current release, SCOPe 2.08