Lineage for d3tnwb1 (3tnw B:176-308)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1274277Protein automated matches [227027] (3 species)
    not a true protein
  7. 1274278Species Cow (Bos taurus) [TaxId:9913] [226306] (3 PDB entries)
  8. 1274279Domain d3tnwb1: 3tnw B:176-308 [216908]
    Other proteins in same PDB: d3tnwa_, d3tnwc_
    automated match to d3ddqb1
    complexed with f18, na

Details for d3tnwb1

PDB Entry: 3tnw (more details), 2 Å

PDB Description: Structure of CDK2/cyclin A in complex with CAN508
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3tnwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnwb1 a.74.1.1 (B:176-308) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvlafdlaa

SCOPe Domain Coordinates for d3tnwb1:

Click to download the PDB-style file with coordinates for d3tnwb1.
(The format of our PDB-style files is described here.)

Timeline for d3tnwb1: