SCOPe 2.08: Domain d3tnnb1: 3tnn B:4-108

Lineage for d3tnnb1 (3tnn B:4-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3tnnb1: 3tnn B:4-108 [216896]
   Other proteins in same PDB: d3tnna_, d3tnnb2, d3tnnc_, d3tnnd2, d3tnne_, d3tnnf2, d3tnnh_, d3tnnl2
   automated match to d1aqkl1
   complexed with cl, gol, so4

Details for d3tnnb1

PDB Entry: 3tnn, 1.95 Å

PDB Description: crystal structure of n5-i5 fab, an adcc mediating and non-neutralizing cd4i anti-hiv- 1 antibody.

PDB Compounds: (B:) Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d3tnnb1:

Sequence; same for both SEQRES and ATOM records:

>d3tnnb1 b.1.1.0 (B:4-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrg

Timeline for d3tnnb1:

• d3tnnb1 first appeared in SCOPe 2.03
  
• d3tnnb1 appears in SCOPe 2.07