SCOPe 2.04: Domain d3tnmb2: 3tnm B:108-208

Lineage for d3tnmb2 (3tnm B:108-208)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3tnmb2: 3tnm B:108-208 [216893]
   Other proteins in same PDB: d3tnmb1, d3tnml1
   automated match to d1aqkl2
   complexed with act, cl

Details for d3tnmb2

PDB Entry: 3tnm, 1.85 Å

PDB Description: crystal structure of a32 fab, an adcc mediating anti-hiv-1 antibody

PDB Compounds: (B:) Fab light chain of human anti-HIV-1 Env antibody A32

SCOPe Domain Sequences for d3tnmb2:

Sequence; same for both SEQRES and ATOM records:

>d3tnmb2 b.1.1.2 (B:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d3tnmb2:

• d3tnmb2 first appeared in SCOPe 2.03
  
• d3tnmb2 appears in SCOPe 2.05
  
• d3tnmb2 appears in the current release, SCOPe 2.08