SCOPe 2.04: Domain d3tnmb1: 3tnm B:4-107

Lineage for d3tnmb1 (3tnm B:4-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3tnmb1: 3tnm B:4-107 [216892]
   Other proteins in same PDB: d3tnmb2, d3tnml2
   automated match to d1aqkl1
   complexed with act, cl

Details for d3tnmb1

PDB Entry: 3tnm, 1.85 Å

PDB Description: crystal structure of a32 fab, an adcc mediating anti-hiv-1 antibody

PDB Compounds: (B:) Fab light chain of human anti-HIV-1 Env antibody A32

SCOPe Domain Sequences for d3tnmb1:

Sequence; same for both SEQRES and ATOM records:

>d3tnmb1 b.1.1.0 (B:4-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgvpd
rfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltvlg

Timeline for d3tnmb1:

• d3tnmb1 first appeared in SCOPe 2.03
  
• d3tnmb1 appears in SCOPe 2.05
  
• d3tnmb1 appears in the current release, SCOPe 2.08