SCOPe 2.03: Domain d3tnld2: 3tnl D:113-291

Lineage for d3tnld2 (3tnl D:113-291)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [226203] (3 PDB entries)

8. Domain d3tnld2: 3tnl D:113-291 [216891]
   Other proteins in same PDB: d3tnla1, d3tnlb1, d3tnlc1, d3tnld1
   automated match to d1vi2b1
   complexed with cl, nad, skm

Details for d3tnld2

PDB Entry: 3tnl, 1.45 Å

PDB Description: 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and nad.

PDB Compounds: (D:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tnld2:

Sequence; same for both SEQRES and ATOM records:

>d3tnld2 c.2.1.0 (D:113-291) automated matches {Listeria monocytogenes [TaxId: 169963]}
dgtgymralkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaek
tvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpe
livsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf

Timeline for d3tnld2:

• d3tnld2 is new in SCOPe 2.03-stable
  
• d3tnld2 appears in SCOPe 2.04
  
• d3tnld2 appears in the current release, SCOPe 2.08