SCOPe 2.04: Domain d3tnld1: 3tnl D:4-112

Lineage for d3tnld1 (3tnl D:4-112)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries)

8. Domain d3tnld1: 3tnl D:4-112 [216890]
   Other proteins in same PDB: d3tnla2, d3tnlb2, d3tnlc2, d3tnld2
   automated match to d1npda2
   complexed with cl, nad, skm

Details for d3tnld1

PDB Entry: 3tnl, 1.45 Å

PDB Description: 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and nad.

PDB Compounds: (D:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tnld1:

Sequence; same for both SEQRES and ATOM records:

>d3tnld1 c.58.1.0 (D:4-112) automated matches {Listeria monocytogenes [TaxId: 169963]}
kiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfr
amnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit

Timeline for d3tnld1:

• d3tnld1 first appeared in SCOPe 2.03
  
• d3tnld1 appears in SCOPe 2.05
  
• d3tnld1 appears in the current release, SCOPe 2.08