Lineage for d3tnlc1 (3tnl C:3-112)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610393Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries)
  8. 1610396Domain d3tnlc1: 3tnl C:3-112 [216888]
    Other proteins in same PDB: d3tnla2, d3tnlb2, d3tnlc2, d3tnld2
    automated match to d1npda2
    complexed with cl, nad, skm

Details for d3tnlc1

PDB Entry: 3tnl (more details), 1.45 Å

PDB Description: 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and nad.
PDB Compounds: (C:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tnlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnlc1 c.58.1.0 (C:3-112) automated matches {Listeria monocytogenes [TaxId: 169963]}
nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit

SCOPe Domain Coordinates for d3tnlc1:

Click to download the PDB-style file with coordinates for d3tnlc1.
(The format of our PDB-style files is described here.)

Timeline for d3tnlc1: