Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.4: I set domains [49159] (25 proteins) |
Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) |
Domain d1vscb2: 1vsc B:1-90 [21688] Other proteins in same PDB: d1vsca1, d1vscb1 |
PDB Entry: 1vsc (more details), 1.9 Å
SCOP Domain Sequences for d1vscb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vscb2 b.1.1.4 (B:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)} fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp vsfgnehsylctatcesrklekgiqveiys
Timeline for d1vscb2: